1.67 Rating by CuteStat

trickphotographyandspecialeffectsreview.net is 1 decade 2 months old. It is a domain having net extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, trickphotographyandspecialeffectsreview.net is SAFE to browse.

PageSpeed Score
78
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.185.108.139

Hosted Country:

United States of America US

Location Latitude:

29.8284

Location Longitude:

-95.4696

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: Not Applicable
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: 2 H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 3
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.185.108.139)

Trick Photography Ideas

- trickphotographyideas.net

how to do trick photography and special effects review

Not Applicable $ 8.95

Trick Photography

- trickphotographyspecialeffects.org

trick photography techniques how to shoot trick photos

Not Applicable $ 8.95

Trick Photography And Special Effects 2nd Edition Pdf

- trickphotographyandspecialeffectspdf.net

how to do trick photography and special effects

Not Applicable $ 8.95

Fundación Instituto Hipólito Unanue

- fihu-diagnostico.org.pe
1,357,204 $ 480.00

509 Bandwidth Limit Exceeded

- ariyatravel.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.4.5
Date: Sun, 02 Mar 2014 06:24:30 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Pingback: http://www.trickphotographyandspecialeffects2ndeditionpdf.com/xmlrpc.php
Link: <http://www.trickphotographyandspecialeffects2ndeditionpdf.com/?p=2>; rel=shortlink
Content-Encoding: gzip

Domain Information

Domain Registrar: GoDaddy.com, LLC
Registration Date: Feb 24, 2014, 12:00 AM 1 decade 2 months 2 weeks ago
Last Modified: Feb 24, 2014, 12:00 AM 1 decade 2 months 2 weeks ago
Expiration Date: Feb 24, 2015, 12:00 AM 9 years 2 months 2 weeks ago
Domain Status:
clientDeleteProhibited
clientRenewProhibited
clientTransferProhibited
clientUpdateProhibited

Domain Nameserver Information

Host IP Address Country
ns1509.websitewelcome.com 192.185.108.133 United States of America United States of America
ns1510.websitewelcome.com 192.185.108.134 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
trickphotographyandspecialeffectsreview.net A 14397 IP: 192.185.108.139
trickphotographyandspecialeffectsreview.net NS 21599 Target: ns1509.websitewelcome.com
trickphotographyandspecialeffectsreview.net NS 21599 Target: ns1510.websitewelcome.com
trickphotographyandspecialeffectsreview.net SOA 21599 MNAME: ns1509.websitewelcome.com
RNAME: root.packard.websitewelcome.com
Serial: 2014022403
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
trickphotographyandspecialeffectsreview.net MX 14399 Target: trickphotographyandspecialeffectsreview.net
trickphotographyandspecialeffectsreview.net TXT 14399 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Domain Name: TRICKPHOTOGRAPHYANDSPECIALEFFECTSREVIEW.NET
Registrar URL: http://www.godaddy.com
Registrant Name: Eunice J. Sanders
Registrant Organization:
Name Server: NS1509.WEBSITEWELCOME.COM
Name Server: NS1510.WEBSITEWELCOME.COM
DNSSEC: unsigned

For complete domain details go to:
http://who.godaddy.com/whoischeck.aspx?domain=TRICKPHOTOGRAPHYANDSPECIALEFFECTSREVIEW.NET

The data contained in GoDaddy.com, LLC's WhoIs database,
while believed by the company to be reliable, is provided "as is"
with no guarantee or warranties regarding its accuracy. This
information is provided for the sole purpose of assisting you
in obtaining information about domain name registration records.
Any use of this data for any other purpose is expressly forbidden without the prior written
permission of GoDaddy.com, LLC. By submitting an inquiry,
you agree to these terms of usage and limitations of warranty. In particular,
you agree not to use this data to allow, enable, or otherwise make possible,
dissemination or collection of this data, in part or in its entirety, for any
purpose, such as the transmission of unsolicited advertising and
and solicitations of any kind, including spam. You further agree
not to use this data to enable high volume, automated or robotic electronic
processes designed to collect or compile this data for any purpose,
including mining this data for your own personal or commercial purposes.

Please note: the registrant of the domain name is specified
in the "registrant" section. In most cases, GoDaddy.com, LLC
is not the registrant of domain names listed in this database.